PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G130600.1
Common NamePHAVU_010G130600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 262aa    MW: 29523.3 Da    PI: 8.4854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G130600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.7e-181360148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W+ eEde l ++v+ +G g W ++a+  g++R++k+c+ rw++yl
  Phvul.010G130600.1 13 KGAWSREEDETLSKYVAIHGEGKWQKVAQNAGLKRCGKSCRQRWLNYL 60
                        79********************************************97 PP

2Myb_DNA-binding47.54.2e-1566110147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg  + +E++ +++++++lG++ W++Ia++++ gRt++++k++w++ 
  Phvul.010G130600.1  66 RGDISVDEEDMIIRLHRLLGNR-WALIAKRLP-GRTDNEIKNYWNTN 110
                         5667899***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-23663IPR009057Homeodomain-like
PROSITE profilePS5129425.796864IPR017930Myb domain
SuperFamilySSF466891.47E-2911107IPR009057Homeodomain-like
SMARTSM007171.6E-151262IPR001005SANT/Myb domain
PfamPF002491.7E-161360IPR001005SANT/Myb domain
CDDcd001674.30E-111560No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2364115IPR009057Homeodomain-like
PROSITE profilePS5129420.32865115IPR017930Myb domain
SMARTSM007178.5E-1665113IPR001005SANT/Myb domain
PfamPF002493.8E-1466111IPR001005SANT/Myb domain
CDDcd001673.68E-1170111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRRPCCPKE INKGAWSREE DETLSKYVAI HGEGKWQKVA QNAGLKRCGK SCRQRWLNYL  60
KPGIKRGDIS VDEEDMIIRL HRLLGNRWAL IAKRLPGRTD NEIKNYWNTN LSKKLQKHPT  120
SSSSVSSLQH KRGEEEKMKQ VHVAPEAPRP RRVSAVEYSK MCSTTPSPSN KVEGSSDEAC  180
FSDFLIDIDQ NQLLIGDDSS SKVPQTDEEQ NNKQVVLTNS PSSSSPSHHC HNLLAEKFDP  240
LETLLDVELK RMASFLGLEN D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135451.10.0hypothetical protein PHAVU_010G130600g
TrEMBLV7AQ420.0V7AQ42_PHAVU; Uncharacterized protein
STRINGGLYMA16G00920.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF153551012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.16e-55MYB family protein